SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3EEW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3EEW3
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0104
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3EEW3
Sequence length 172
Comment (tr|H3EEW3|H3EEW3_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA08269} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN= OC=Neodiplogasteridae; Pristionchus.
Sequence
MRPSRYQATCRFWNYGRAPACRMHWLSSLCVEVDELAASREKELAEEEKRLREREAKIHE
LNEFVEAKRLELDEASLQSAPASVEEAVFRVAAHGLFEEQLKERQANVDALTKGRRRDGE
GSGRRSRRTRQSMARPVDGFDRSCGPVGEGSGVAGGIEETGEMAVSGVEGMQ
Download sequence
Identical sequences H3EEW3
PPA08269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]