SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3EIL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3EIL3
Domain Number - Region: 6-60
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0302
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3EIL3
Sequence length 105
Comment (tr|H3EIL3|H3EIL3_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA09583} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00099137 OC=Neodiplogasteridae; Pristionchus.
Sequence
MTIMNLRSADSPASSTESIQRLLDEVKRLKAENQKLRGKVEVDLSNSQDLKEWPRKDLLK
LIAQLESKEVRKPVQAAVKKLQEMGDTMSLHDQLKLARETVDSLK
Download sequence
Identical sequences H3EIL3
PPA09583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]