SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3EIS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3EIS5
Domain Number 1 Region: 6-156
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-31
Family SH3-domain 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3EIS5
Sequence length 171
Comment (tr|H3EIS5|H3EIS5_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA09645} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00099199 OC=Neodiplogasteridae; Pristionchus.
Sequence
MEKVADYKAVAFSICTNVEYDGSLDDDSPVHGCAVSFKIKDYLHIKEKYNNDWWIGRLVK
EGCDLGFIPSPVKLETLRMQQQKGGAKFKQSTSTSNLGNLDAMMPRSGSRGSSPPTPGIH
DDEHKNLKNVVTTPPTKEKKKLIFKKQEVLNPYDVVPSMRPVVLVGPSLKG
Download sequence
Identical sequences H3EIS5
PPA09645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]