SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3EKH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3EKH4
Domain Number 1 Region: 271-329
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-19
Family SH3-domain 0.00094
Further Details:      
 
Domain Number 2 Region: 47-141
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000241
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000314
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3EKH4
Sequence length 358
Comment (tr|H3EKH4|H3EKH4_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA10257} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00099811 OC=Neodiplogasteridae; Pristionchus.
Sequence
MGVVVSTLLLFLPEEETFWTMTALIEDILPANYYSTNLLGLQADERCLVDNDVESSLVLI
NWFLTLLSSVTKTKTLLRIWDLVFYQGSVVLFRTILSMMKMKEEELVELAESTKSSADIF
NALCQIPSTLTDDDRLFEYVRSFEFSVTDHLINELRKKYQAILMADQGTIVNVATDTNLP
KQKMQRRKVARSKSIITNMFSSSDKAENDPKTKNIRQTELLVDLRESILQVCRYFGECDQ
ELALTIITQADYTPQSHEKDMSNFLSGRRQGKKRARALLDFARQDEDELGFRKNDIITII
SEKDEHCWVGEVNGLRGWFPAKFVEETSSRRARQNVFVVWRRGGVARCKIAFMSLLFT
Download sequence
Identical sequences H3EKH4
PPA10257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]