SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3F549 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3F549
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3F549
Sequence length 81
Comment (tr|H3F549|H3F549_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA17273} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00106827 OC=Neodiplogasteridae; Pristionchus.
Sequence
MPRQVQAEFDFEAQPGTSELNLTAGEILTVLQDNVEGGWVEGKNARGKIGLFPATYVIPY
SGPSGKNRETSIEIGDLLCVP
Download sequence
Identical sequences H3F549
PPA17273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]