SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3FJ31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3FJ31
Domain Number 1 Region: 49-173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000456
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3FJ31
Sequence length 1022
Comment (tr|H3FJ31|H3FJ31_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA22282} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00111836 OC=Neodiplogasteridae; Pristionchus.
Sequence
MEKITEHETSPSAEISLRMIAQIKKVDLPALAAILGRLMDVHASCDDGELQWNVLKSEWT
RLRDAVDVRDNQLRKILQNVAEYVQEAEDFKMRVDKIMAYLSSTTYADHTEELGSVQQIK
REDIPYLESCLDRLLDLLVKGKYQGLQKGLQFDELVQQWQRLCDVVKSREGLLLEKLSKP
RFIEEVFVDDTVISEEDSNNPVDETCWKTPPERLSDYVEKAKDFQFRIRDINEQIASISS
ANYSQALQIIRRINRDQRPHLLKSFCRLEELFPLCYLVPTGLWPEMLRPEWKRLRETLEK
AEAQALSWKSVEEMREAKEGEVLPEQEKQNDIRWRSEEDQRRSGKYQSNVYQSPSERQNA
RVSFHRKLHSEMEQRFKKTGKVATEEGDNRPYDINREIEEEELSSLEVEDIRMRLEDENR
KKEKEKANADFDKMRNIWEELKRKRMEENTLEEEKGKKEEEERKRLEEEKKKRIEEENRK
KEEEERNRRIEEEMMKRMEEERRKKEEEERIRMIEEVKRLDEERKKRIEEEKRKKEEEEM
KRLEEERKKRIEEEKRKKEEEEMKRLEEERKKRIEEEKRKKEEEEMKRLEEERKKRVEEE
KRKKDEEEMKRLEEEKKMRIEEEKRKKEEEEMKRLEEERKKRIEEEKRKKEEEEMRRLEE
ERKKRIEEEKRKKDEEEMKRLEEEKKKRIEEEKRKKEEEKNMILVEERKKRIEEEKKKEE
EEEMKKRFEEEKMKEDEIIRVQNQELERQRTAIDKKKEEERQQRVKSTSLGKPVRPLDVS
RQLQQLQDESEKDEDERRALLERARRENRKWEAERLEATIREHDRQAKALRRERDEDERR
AVLERARRENRKVDAKRLEVTRCKPEQQKAPTTFPNSQRELEKRRKQELEKRLKEMEEQT
FQVCTLWGQEELHLLGFSNGKKLRPDEAEKRMRERNDILPAQRITFDQIRNRITTLLSQK
KEHQRKEHGNRQRRYVKLIDDFERDLAEEGISLDDIEEEVDLERPLDEDDLIITSHQTKS
TI
Download sequence
Identical sequences H3FJ31
PPA22282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]