SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3GJH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3GJH2
Domain Number 1 Region: 62-259,457-573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000598
Family Glycosyl hydrolases family 16 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3GJH2
Sequence length 757
Comment (tr|H3GJH2|H3GJH2_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra76315} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MWYQQSAVWAFAVIWVATTASVLAKNSTTASTTYPTKSGIRTWVDPDTPKNRQKYTSSRG
REWDLVMSDEFNVANRSFRPGDDHIWTSLEKPDGVNGALELYSHNMTSTKCDDDGTCYFY
IKAMDELNVIHVYNMYTHPPGYVDAYFFYRAAMVQSWNKFCFQGGMLEVRAQLPGAVSAA
SGNPDLALGNNAKVQTTKYYPTWPGIWMMGNLGRAIFSASTNRMWPFSYDKCEPDVFNPD
NQRISACDDDPGYGLNPNQGRGAPEIDVLEGGGLAVSSSLQIAPGMPDNYRLFPVDTSIG
DNLYCVYGYTCTTPGANYIDVPTAYYKEERGHRSWYQGLRYASNNFCQQNPEAKQTYATV
AASLKAGITENSCSVETCPASGDVNADIGLIDDVGENHWGINTNGTCYPLVNSYMGSYLC
DPDNTNSKCASPRNESTTPKSNAMSSFNYQMDAISSNWPVHLGAYTDYVDYQIEWVTGSK
GYVRWMLQGNPLFEVTTDAFSNVPQNASKKNPQKVMLEEPMSLILNVALSSSWGATPPNA
GKECRGDGADDVTNKICDSFPMYLKMDYMRLYQDLGDDLDADNYMQVGCDPASHPTKKWI
EGHIDEYEDDDNQWKEVSGKAFCSVDDDCTIGGNLGKTALKTGKCVKSRCQCTYSSSWGG
PRCTTAISSSSSSGSTSKSSYGPPMGLSIGLAGIIVFLSFISVYWSIFAVVKTKSVTEMK
KSAIYDQDDGPMRQSKASYPNDLGQRQPRDNYSQNFV
Download sequence
Identical sequences H3GJH2
164328.JGI76315 jgi|Phyra1_1|76315|fgenesh1_pg.C_scaffold_17000077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]