SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3GJT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3GJT9
Domain Number 1 Region: 17-92
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.1e-26
Family Chaperone J-domain 0.00032
Further Details:      
 
Domain Number 2 Region: 213-315
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.04e-18
Family PDI-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3GJT9
Sequence length 471
Comment (tr|H3GJT9|H3GJT9_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra76456} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSRSTRVLLALLLALALASIHAMDPSKDYYKVLGVDKEFSDRELKKSYRQLALKFHPDKA
ENAEDKEAAKEKFVEVSEAYEVLSDPDKRKEYDDARRFGGGAPGGGAGGQRKRRSTNENM
ASFTKMFESVFGHGFGGGSGGFSGGAGGFGGAGGFGGGFPGGAGFGGGMGQGGGGGMHNE
FHFEGMDGFGQAQRPSAAYTGERRARQPTTLFAKDSPVKSLSKRKFPGKEANNEWLVQFY
AMDATCAKFRENYESIARDLEGKVRVGAVNCDKHAAVCRAHGVETYPSFVYVWEGKEIKY
QGELDEYQVYNFAIEKHIARLHRLRDSGEIEKLHAGNEANLCNVGKKATTAASSLCAVFV
LSGDKKQREKELKVAKEVAAKFRHSKALKIAYVDWKTEKRTVRKLLETVVGHSHRQQEPG
LMVIRTKRGKTRVGVHPLDADFTADALSATMERAVGGDLPLSNVHGTVHFH
Download sequence
Identical sequences H3GJT9
164328.JGI76456 jgi|Phyra1_1|76456|fgenesh1_pg.C_scaffold_18000087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]