SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3GMI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3GMI5
Domain Number 1 Region: 25-171
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.00000000000406
Family Osmotin, thaumatin-like protein 0.0013
Further Details:      
 
Weak hits

Sequence:  H3GMI5
Domain Number - Region: 450-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0193
Family Glycosyl hydrolases family 16 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3GMI5
Sequence length 588
Comment (tr|H3GMI5|H3GMI5_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra77713} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MVKVFLALSAALVMAAPVAASVSVSFVNSCSYAISLYDNSKTESIAAGSSMSRDLASGYN
GMFRDGTSDEATLAEFSVTGGYTWYDISVIPPGSGSCSSYDACKELTGKSGYNVALSIAP
DTSSTKSVSSSCATLTCESEECSDAYLYPSDDSKTHSCPDTLPFTVTFCPGGSSSSTTTT
TTTSSSAAQQSSQSTTTSAPTATTATPEVQSDYKSGTVITSSGSTTTAPTSTTAAPTTAP
STSQTQTQTSTSTTSTSTTTTSTGTAASFSSATISSSFAYTGTDAGSAAGTYGKVTEMSS
CTTEDVSLTDPVGPMSEEVSLVFRGPMSIYNIAVFNASSGSDWSKVSAYSQNGTQDNMVF
MNNLNIDYTGADSSPQGYATDDGSGTATSSTAFGGSLADASDSSVTGGGPCVSTGCEVNI
MTETNCADEDGCIGYYDDMGFHGWDGGMKMFVTKVQMPTGDSVNRPAIWMLNAQVVRANQ
YGCNCRGEGAEGGCGELDIAEVIETNTDKDKVSTHYYFYDGSVSAGGDNYASRPTDSAVT
YVTIIDNSSDGSIKIIELGGDDFDFDVDAVTADQVTSWLSASVENLLS
Download sequence
Identical sequences H3GMI5
164328.JGI77713 jgi|Phyra1_1|77713|fgenesh1_pg.C_scaffold_26000056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]