SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6NMQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6NMQ1
Domain Number 1 Region: 79-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000471
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 205-270
Classification Level Classification E-value
Superfamily ClpS-like 0.0000314
Family Ribosomal protein L7/12, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H6NMQ1
Sequence length 286
Comment (tr|H6NMQ1|H6NMQ1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AFC30388.1} KW=Complete proteome; Reference proteome OX=1116391 OS=Paenibacillus mucilaginosus 3016. GN=PM3016_3567 OC=Paenibacillus.
Sequence
MALRAGTGRRPRVTLEILSIKVVISVETVYQEIDAVIAKMQAALEEKREQHPDHYAKYPM
QLMTTAEDQALRSVTGTWSLPEEYLYFLKHYVPESVSWSTDEYMNMDIYGAKDLLQGQSG
YNYNHVTDEVIADWPRDYLVIASDEGDPYCIDLSRGDTVIYTAVHGAGSWDFSVAYDNLL
EFLHSMLRPASTGEWEDGADEPYDYCHVYITGPGTDKIKTWVFIKKRFSCDYAQAKTYLE
AAPLLVYKGLDSGAVKLVDELKSIGADYELRQISQDEFLGIGSYRS
Download sequence
Identical sequences H6NMQ1 I0BJW7
WP_014370350.1.53882 WP_014370350.1.63014 gi|386724103|ref|YP_006190429.1| gi|379721406|ref|YP_005313537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]