SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H6RJR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6RJR1
Domain Number 1 Region: 10-260
Classification Level Classification E-value
Superfamily Cgl1923-like 4.84e-87
Family Cgl1923-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H6RJR1
Sequence length 289
Comment (tr|H6RJR1|H6RJR1_BLASD) Putative ATP-grasp superfamily enzyme {ECO:0000313|EMBL:CCG03564.1} KW=Complete proteome; Reference proteome OX=1146883 OS=Blastococcus saxobsidens (strain DD2). GN=BLASA_2689 OC=Blastococcus.
Sequence
MIDPKSGADDLPQLTDPLVVVAFEGWNDAGDAATGAVEHLELIWDAKPLAALDPEDYYDF
QVNRPTVSLVGGVSRRIEWPTTRISVAHPEGLGRDVVLVRGIEPNMRWRGFCEELLEILD
ELDVSMVVGLGALLADTPHTRPTPVTGSAYDQESARAYGLETSRYEGPTGILGVFQDACV
QAGLPAISFWAAVPHYVSQPPSPRATVALLQRVEEVLETAVPLGALPQQADEWVTTVDEM
ANEDAEVVEYVRSLEERATEVDLSQANGDQIAREFERYLRRRGGSAGGT
Download sequence
Identical sequences H6RJR1
WP_014376447.1.69969 gi|379736089|ref|YP_005329595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]