SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6RM17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6RM17
Domain Number 1 Region: 39-235
Classification Level Classification E-value
Superfamily Sortase 1.03e-28
Family Sortase 0.012
Further Details:      
 
Weak hits

Sequence:  H6RM17
Domain Number - Region: 2-15
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0259
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H6RM17
Sequence length 255
Comment (tr|H6RM17|H6RM17_BLASD) Putative Sortase protein {ECO:0000313|EMBL:CCG01259.1} KW=Complete proteome; Reference proteome OX=1146883 OS=Blastococcus saxobsidens (strain DD2). GN=BLASA_0281 OC=Blastococcus.
Sequence
MPPPPPPPPAVRPAPGRWRAVAQGTGELLVTGGLVVLLFVGYEVYVTDLLTERRQDQLSV
ELHERWEEDAPAEAGLVQVEIGDAFGVLRIPRLGEDYARVILEGTTEAELSQGPGHYAGT
AMPGEPGNVALAGHRVGKGSPFLELDLVQPGDPIVVETADSWFVYRVLGNAATGNVDTDP
SGIPGRHIVRPETIEVISPTPNASADAAPTGAYLTLTTCHPRFSARQRLIVHARLDGAGI
PKAEMPDGPPALRES
Download sequence
Identical sequences H6RM17
gi|379733803|ref|YP_005327308.1| WP_014374176.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]