SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6RNU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6RNU0
Domain Number 1 Region: 79-210
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.15e-26
Family GntR ligand-binding domain-like 0.0084
Further Details:      
 
Domain Number 2 Region: 12-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.86e-16
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H6RNU0
Sequence length 234
Comment (tr|H6RNU0|H6RNU0_BLASD) Transcriptional regulator, GntR family {ECO:0000313|EMBL:CCG05238.1} KW=Complete proteome; Reference proteome OX=1146883 OS=Blastococcus saxobsidens (strain DD2). GN=BLASA_4431 OC=Blastococcus.
Sequence
MTTANVFSSKGDAAYAELRARILRGDLPPGSRLAQHELASTLGMSLTPLREAIRRLSSEG
LIDLDTHRDARVAAMNATEARQLFEVRLSLDPTAAGLAAEHRTEADLAALRGAADRLLPV
TRAWGEDALDAHRAFHRALYVASHNDVLVRMLDDLWDKGDRYRRLGLDLPPGDQPRTRDH
REHHELVELITARDSTGAAELMRTHIERSLTAAAITALEHRRHEQADPGTGSTR
Download sequence
Identical sequences H6RNU0
WP_014378106.1.69969 gi|379737758|ref|YP_005331264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]