SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6WQN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6WQN1
Domain Number 1 Region: 36-245
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.62e-112
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000225
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.00000000000184
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H6WQN1
Sequence length 245
Comment (tr|H6WQN1|H6WQN1_9ARCH) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AFA53788.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
FISAYAMCAGEAAVADLSFAAKHAALVSMGEMLPARRARGPNEPGGLSFGHISDIVQTSR
TSEDPAKIALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNVYYDIDYIN
DKYNGAANIGKDNKIKATLDVVKDIATESTLYGIETYEKFPTALEDHFGGSQRATVLAAA
AGVATALATANANAGLSGWYLSMYLHKEAWGRLGFFGYDLQDQCGATNVLSYQGDEGLPD
ELRGP
Download sequence
Identical sequences H6WQN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]