SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6WQV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6WQV0
Domain Number 1 Region: 43-259
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 6.28e-119
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000146
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.22e-17
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H6WQV0
Sequence length 259
Comment (tr|H6WQV0|H6WQV0_9ARCH) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AFA53857.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSFISAYAMCAGEAAVADLSFAAKHAALVSMGEMLPARRARGPNEPGGLSFGHIS
DIIQTSRTSEDPAKIALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNVY
YDVDYINDKYNGAANVGKDNKVKATLDVVKDIATESTIYGIETYEKFPTALEDHFGGSQR
ATVLAAAAGVATALATANANAGLSGWYLSMYLHKEAWGRLGFFGYDLQDQCGATNVLSYQ
GDEGLPDELRGPNYPNYAM
Download sequence
Identical sequences H6WQV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]