SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H7BYF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7BYF4
Domain Number 1 Region: 13-54
Classification Level Classification E-value
Superfamily UBA-like 0.0000000391
Family TAP-C domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H7BYF4
Sequence length 125
Comment (tr|H7BYF4|H7BYF4_HUMAN) UBX domain-containing protein 7 {ECO:0000313|Ensembl:ENSP00000371311} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=UBXN7 OC=Catarrhini; Hominidae; Homo.
Sequence
XAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPS
TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGVRQEQELRNGGAIDKKLTTLADLF
RPPID
Download sequence
Identical sequences H7BYF4
ENSP00000371311 ENSP00000371311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]