SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H7BZ97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7BZ97
Domain Number 1 Region: 19-185
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-32
Family Integrin domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H7BZ97
Sequence length 258
Comment (tr|H7BZ97|H7BZ97_HUMAN) Integrin alpha-6 {ECO:0000313|Ensembl:ENSP00000388435} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ITGA6 OC=Catarrhini; Hominidae; Homo.
Sequence
TSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFR
ESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILR
SRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGV
PWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYID
NLEKKQWITKWNENESYS
Download sequence
Identical sequences H7BZ97
ENSP00000388435 ENSP00000388435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]