SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H7C009 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C009
Domain Number 1 Region: 122-326
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.75e-69
Family PDEase 0.0000418
Further Details:      
 
Domain Number 2 Region: 37-117
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000142
Family GAF domain 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H7C009
Sequence length 327
Comment (tr|H7C009|H7C009_HUMAN) cGMP-dependent 3',5'-cyclic phosphodiesterase {ECO:0000313|Ensembl:ENSP00000392457} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PDE2A OC=Catarrhini; Hominidae; Homo.
Sequence
FPTASSVPEHKGVGFHAWDVRNLRKLRGQVPAGSLPPTDPSLHRWFLAPLPSPEVIGVAE
LVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSD
DEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTL
ARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLD
HRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLD
LMRDIILATDLAHHLRIFKDLQKMAEG
Download sequence
Identical sequences H7C009
ENSP00000392457 ENSP00000392457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]