SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H7C0I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C0I5
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000824
Family Cystathionine synthase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H7C0I5
Sequence length 140
Comment (tr|H7C0I5|H7C0I5_HUMAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSP00000395201} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
XGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVDY
TVEKCIQHVKRLREMSLKVGFNWLPTGLTWPLLLVKEIHLLFYQVCVVSAQHGCGHPFAR
SPNCGGDHGHSPLLLWIDHS
Download sequence
Identical sequences H7C0I5
ENSP00000395201 ENSP00000395201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]