SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H7C1V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C1V6
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000759
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H7C1V6
Sequence length 63
Comment (tr|H7C1V6|H7C1V6_HUMAN) Presenilins-associated rhomboid-like protein, mitochondrial {ECO:0000313|Ensembl:ENSP00000402689} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PARL OC=Catarrhini; Hominidae; Homo.
Sequence
HMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGAMVCY
LRS
Download sequence
Identical sequences H7C1V6
ENSP00000402689 ENSP00000402689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]