SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H7C5U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C5U2
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily vWA-like 1.22e-29
Family Integrin A (or I) domain 0.0000165
Further Details:      
 
Domain Number 2 Region: 323-400
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.79e-17
Family Integrin beta tail domain 0.00058
Further Details:      
 
Domain Number 3 Region: 112-156
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000288
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 4 Region: 282-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Integrin beta EGF-like domains 0.0032
Further Details:      
 
Domain Number 5 Region: 239-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000218
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  H7C5U2
Domain Number - Region: 208-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 164-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H7C5U2
Sequence length 401
Comment (tr|H7C5U2|H7C5U2_HUMAN) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ITGB5 OC=Catarrhini; Hominidae; Homo.
Sequence
XKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEK
LAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNASFEVSLEA
RSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS
PGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCEC
DNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLC
GQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVD
TIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLRE
Download sequence
Identical sequences H7C5U2
ENSP00000420814 ENSP00000420814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]