SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H8I9J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H8I9J6
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.33e-22
Family Terpene synthases 0.0039
Further Details:      
 
Domain Number 2 Region: 70-256
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000000017
Family Terpene synthases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H8I9J6
Sequence length 262
Comment (tr|H8I9J6|H8I9J6_METCZ) Uncharacterized protein {ECO:0000313|EMBL:AFD00041.1} KW=Complete proteome OX=1041930 OS=HZ254). GN=Mtc_1287 OC=Methanocellaceae; Methanocella.
Sequence
MDTLEKAIKFLMGSQRADGSWGNGDPFVCARVMLALKDDAPEGMLLKGLKYLEGRQETDG
HFKPVGGMYSDATSTAYALIVLNKFDYGKASLPVSRGIVWLVESQNKDGSWGKNKEKKAY
TTTFCLRALHAFYLSGINRFARGLEFSLGYLRGLDFSREPVSHVYAPILNLYRMSYLDEG
LRDKFFEFALDAAEPALEGGSVADVAYLLGTLKALGEADVSAALEEWLAAAQHDDGSFGK
DLASPGDPNWTALVALAIKGML
Download sequence
Identical sequences H8I9J6
gi|383319718|ref|YP_005380559.1| WP_014405878.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]