SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H8MXU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H8MXU4
Domain Number 1 Region: 219-527
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.23e-64
Family Thermolysin-like 0.0000019
Further Details:      
 
Domain Number 2 Region: 531-643
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.45e-23
Family alpha-D-mannose-specific plant lectins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H8MXU4
Sequence length 644
Comment (tr|H8MXU4|H8MXU4_CORCM) Bacillolysin {ECO:0000313|EMBL:AFE09633.1} KW=Complete proteome; Reference proteome OX=1144275 OS=/ M2) (Myxococcus coralloides). GN=COCOR_06712 OC=Cystobacterineae; Myxococcaceae; Corallococcus.
Sequence
MMTAHRIRGLATLGVLVGLSACQGMEEHEKRTGAEPDASLGVTISELQVVGADEGHVPTF
ANGNFGQLRLGGKERTEEAEVSALRPSLLAVSKVFHADPAELAFQRAVTDGMGDRHFVYV
QRKHGREVLGAALVLHTRNDAVYAVHGNARADLDAPRDARLSPEDAIAVARQDSARLDRV
EVEAHPRMAYWPAGEKLDLVYRVNVTGRSKDGMAVDDDVIINAVSGSVVQRLPNIYTLKN
RAVYDVNHGGSANLPGTLARAEGGATVADPTVNTNYDLLGTTYDCYKSLFNRDSYDGAGS
RLVSSVHYGYGYANAAWIGSKNQMLYGDGDGVTFGSMVNALDVTAHEVTHGLTISTSNLL
YFAEPGALNESMSDIMGSVCEWYRNGQVVNANTWKCAEEIYTPATSGDALRYMNDPRLDG
QSLDYFDQTFSPFTDVHYSSGIPNLAFYLLSQGGQHPRGRSSIAVRGIGIAKAAQVFHRA
NTVLLLGKTMATFADAKLATEQAAAQLGYSAADIASVTAAWQAVGVGPSILVAGQGLWLG
QPMVSNDRRFSLVLQNDGNLVLWFGQSALWTSNTAGQGALSAHMQDDGNFVVYRTSTPTV
GQAVWSSMTWGHPGAYLILQNDGNLVIYDKDGVTPLWNSGTWGH
Download sequence
Identical sequences H8MXU4
gi|383458676|ref|YP_005372665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]