SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9C8R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9C8R2
Domain Number 1 Region: 15-115
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 4.18e-40
Family Chemosensory protein Csp2 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9C8R2
Sequence length 120
Comment (tr|H9C8R2|H9C8R2_BOMMO) Chemosensory protein 14 variant {ECO:0000313|EMBL:AFF18121.1} OX=7091 OS=Bombyx mori (Silk moth). GN= OC=Bombycoidea; Bombycidae; Bombycinae; Bombyx.
Sequence
MACVAVTWARPESTYTGRWDNINVDEILESNRLLKGYVDCLLGKGRCTPDGKALKETLPD
ALEHECVKCTGKQKSGADKVIRHLVNKRPDLWKELAVKYDPDNIYQARYKDKIDAVKGSA
Download sequence
Identical sequences H9C8R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]