SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9ES69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H9ES69
Domain Number - Region: 168-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0425
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9ES69
Sequence length 533
Comment (tr|H9ES69|H9ES69_MACMU) Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase {ECO:0000313|EMBL:AFE65228.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=MGAT3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQA
SPEPGDPDLLRTPLYSHSPLLQPLPPSKAAEELHRVDFVLPEDTTEYFVRTKAGGVCFKP
GTKMLERPPPGRPEEKPEGANGSSARRPPRYLLSARERTGGRGARRKWVECVCLPGWHGP
SCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCES
NFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTQDG
VSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWKQPGTLE
VVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCS
WCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEH
MYAPKYLLKNYDQFRYLLDNPYQEPRSTAAGGRRHRGPEGRLPARGKLDEAEG
Download sequence
Identical sequences A0A0D9SD51 A0A2K5UFV4 H9ES69
XP_005567285.1.63531 XP_005567286.1.63531 XP_005567291.1.63531 XP_007974027.1.81039 XP_007974028.1.81039 XP_007974029.1.81039 XP_007974030.1.81039 XP_011710610.1.29376 XP_011710611.1.29376 XP_011710612.1.29376 XP_011710613.1.29376 XP_011710614.1.29376 XP_011887223.1.92194 XP_011887229.1.92194 XP_011887235.1.92194 ENSPANP00000013366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]