SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9F513 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9F513
Domain Number 1 Region: 315-455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 418-550
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000628
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 156-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 280-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000914
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 5 Region: 190-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000026
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  H9F513
Domain Number - Region: 239-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9F513
Sequence length 657
Comment (tr|H9F513|H9F513_MACMU) Fibulin-1 isoform C {ECO:0000313|EMBL:AFE69722.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=FBLN1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
VDADVLLEACCADGQRMATNQKDCSLPYATESKECRMVQEQCCHSQLEELHCATGIRLAN
EQDHCAAPRGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFRACCVK
SQETGDLDVRSLQETDKITEVQEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQ
LLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDEC
ESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPTGHTCI
NTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGRGHRCVNSPGSFRCECKT
GYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYICSCSVGFRLSVDGRSCEDINECS
SSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQ
CSCPSSGYRLAPNGRNCQDIDECVTGIHNCSVNETCFNIQGGFRCLVFECPENYRRSAAT
RCERLPCHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNE
EGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLYRHGTVSSFVAKLFIFVSAEL
Download sequence
Identical sequences H9F513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]