SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9FXX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9FXX3
Domain Number 1 Region: 173-397
Classification Level Classification E-value
Superfamily TPR-like 5.69e-31
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 
Domain Number 2 Region: 71-201
Classification Level Classification E-value
Superfamily TPR-like 4.67e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9FXX3
Sequence length 519
Comment (tr|H9FXX3|H9FXX3_MACMU) Bardet-Biedl syndrome 4 protein {ECO:0000313|EMBL:AFE79482.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=BBS4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAEERVATRTQFPASTESQKPQQKKAPEFPILEKQNWLIHLHYIRKDYEACKAIIKEQLQ
ETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA
IEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLL
EGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAIL
AAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLA
PFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRA
YAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVNLLKDNSSVEFDSEMVEM
AQKLGAALQVGEALVWTKPVKDPKSKHRTTSTSKPASFQQPLGSNQALGQAMSSAAAYRT
LPSGAGGTSQFTKPPSLPLEPEPAMESSPTETSEQIREK
Download sequence
Identical sequences A0A096NMN0 H9FXX3
ENSPANP00000014239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]