SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9GCR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GCR2
Domain Number 1 Region: 180-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.43e-43
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 2.94e-32
Family Tetramerization domain of potassium channels 0.00000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9GCR2
Sequence length 647
Comment (tr|H9GCR2|H9GCR2_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000007367} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN= OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MAAGVAAWLPFARAAAVGWLPLAKKPMPKPPPDKKRRTDEILVVNVSGKRFQTWKNTLDR
YPDTLLGSSEKEFFYDEDSTEYFFDRDPEMFRHILNFYRTGRLHYPRHECIQAFDEELSF
YGIIPELIGDCCLEEYRDRKKENAERLAEDEEAEIATDTALPPDSTFRQRLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETIPCRPPPGKKRNQPCGERFPNAFFCMDTACVLIF
TFEYLMRLFAAPSRFKFMKSVMSIIDVVAIMPYYIGLVMPENENVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTAETNFTSIPAA
FWYTIVTMTTLGHSDMLGQQICRRVYGSFAALLSSHVCFFSLPLPVLFSYKNFARSYFQN
HRMDMREASHKLPLPRKKRGKEGTCLSFLKQKLNNTLQASDRDPDTHALAVRNRSAFEQQ
HHHLLHCLEKTTSHEFTDEHSYSEFCLTEPLGYRTSRSTSLSSQQGSKGGLSSSCCPRRT
KRRPTRLTNSTMTMSRASAQELDTINSQKSAAPQSRSSLNAKTHDNLKLNCDTPDFTAAI
ICIPTPPANTPDESRPPSPGGGSSGPLRNSSLSTPYILHETVKISSL
Download sequence
Identical sequences H9GCR2
ENSACAP00000007367 ENSACAP00000007367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]