SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9GMJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GMJ3
Domain Number 1 Region: 713-940
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-59
Family DBL homology domain (DH-domain) 0.00000000608
Further Details:      
 
Domain Number 2 Region: 307-484
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.95e-52
Family Regulator of G-protein signaling, RGS 0.000000103
Further Details:      
 
Domain Number 3 Region: 944-1077
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-39
Family Pleckstrin-homology domain (PH domain) 0.00000158
Further Details:      
 
Domain Number 4 Region: 25-117
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.023
Further Details:      
 
Weak hits

Sequence:  H9GMJ3
Domain Number - Region: 145-175
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9GMJ3
Sequence length 1466
Comment (tr|H9GMJ3|H9GMJ3_ANOCA) Rho guanine nucleotide exchange factor 11 {ECO:0000313|Ensembl:ENSACAP00000015361} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=ARHGEF11 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
FSHSCRLSSLSSLGDSAPERRSPGHHRQPSDASETTGLVQRCVIIQKDQHGFGFTVSGDR
IVLVQSVRAGGAAMRAGVQEGDRIVKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSPPA
SAGLSGSQQDGHQTGAPQVMPASPPPPPPPPLPPPHHITEPKPLQDPKFQKHATQILRNM
LRQEEAELQEGGGLPVCDPTSSLLLGGRLSLDSQDGDSGLDSGTERFPSVSEISLNRNSV
LSDPGLDSPHTSPVIASRMFQHHQHQGSDTSFSPSLAEQGFDQTGRPLIIAPEEDCDPGY
FNNECDSLFQDLGKLKTRPAHLGVFLRYIFSQADPSPLLLYLCADIYQQMNPKEGRGLGK
EIWNIFLEKTAPLRVRVSDSLLAEIESRLRNGEDLRNAFLELQEAVMPEIQEQIQDYRTK
RTMGLGSLYGENDLLDLDGDPQKERQVAEKQIAQLGDILSKYEEDRSSPMSFALNTYMGH
AGIRLRESRLVSVVEKSQEKDKWLPFFPKTKKGQQSSSTKKDKETLAEDKKRNPILKYIG
KPKSSSQSTFHVPLSPVEVKPGNVRNIIQHFENNQHYDPQQLDLQRLSTGSFPEDLLDME
SSRSEVKLGRSESLKGREELKRLRKADNVPRSRSDVDMDAAAEATRLHQSASSSASSLSA
RSLENPTPPYTPKMGRRSIESPSLGFGTDVFLPHLLEDELGQLSDLEPEPDSQNWQHTFG
REIAASLPQREVDRQEVINELFVTEASHLRILRVMDVVFYQRMKKENLISREELGLIFPN
LPEVIEIHNSLSEAMKKLREDGPVVKEIGDLMLSRFDGVAREEIQQVAADFCAYQSAALE
LIKTKKRKETRFQLFMQEAESNPQCRRLQLKDLIISEMQRLTKYPLLLENIIKYTHGETS
EHQKLCRARDQCREILRYVNEAVKRAENQHRLEAYQKRLDATSLERTSNPLAAEFKNLDL
RSRRMIHEGLLSWRISKDKTADLHVLLLEDLLVLLQRQDEKLVLKCHSKMALGSSDIKQT
FSPVLKLNSVLIRSVATDKRALFIICTSELGPQIYELAASTSSEKNTWMGLLDEAVKNAT
RNATLPPKRHSQEVPLPPAAPSSPRYLGSVRPKIHHTVLDTCLVLQDADMTQDSCASSQD
AEEEQEEVEEQEEEEQEEEEEDNCIFTCPTTLLLPITPTDETPTDTLLEETHPVPTEESL
AESAMEDVETLRHLLLRSFLPCRDPDEDVTPTPSVAGTHPHWDSVLASQDSGSQEEPTDK
RPLSDQPRGMDEGLCCLLGLKGRARGGNGASSQETETGLSLYTSPEALVGMQRVELALHL
GLGGKLSPALLSRSHAHPSKPRPFPGGAESYFSWKGGGRPRNCFYLSLPAGLGESHTDAG
STSPAAAPDASCQAKSLPPAGPSTGSQGPSKAIRDVDVIFRTIEQLTLKLTRLKEVEMAH
QQLLRSLSTAADAAPMGNALPEPSWM
Download sequence
Identical sequences H9GMJ3
ENSACAP00000015361 ENSACAP00000015361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]