SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9GQC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GQC0
Domain Number 1 Region: 34-119
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.34e-27
Family SCAN domain 0.00025
Further Details:      
 
Domain Number 2 Region: 574-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 690-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 615-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 213-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000379
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 
Domain Number 7 Region: 667-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000164
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 8 Region: 451-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000176
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9GQC0
Sequence length 744
Comment (tr|H9GQC0|H9GQC0_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000018099} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN= OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MERPNSRGPEAGPGGSGESWERTRHESLSVDLDSSDTQRQRFRQSSYQEGEGPRGVCSRL
HDLCRQWLKPEQHTKAEVLDLVTLEQFLSILPPEMGSWVRECGAETCSQAVALAEGFLLS
RAEDKEQEGQDGTDVGDKQGPAPSASFPTCSAPPSLPSDTTQSLRQKELKREGDGAAALQ
DYVVTSLELQGEIQGSHGDLLSALGRPHLKLHCVQDVAVDFSLEEWVLLNPDQKALHKQI
MEEMNGIVASLGKAPSLMGFLFQKLKWEDFHNWSQVKVSRRGIEQPSNSAPLLQVKHSVY
LFHPKCIGIRAEQRDSRQNDISKKSQDFVRKLIVEHSAHNEQSKELSVCETEAFMKKKFK
NLLKLKTGDQMLNCDETGLSCKVLPNSTLSPRGDSGQITIHVSLCNSIFIISETLLYSEI
REHGKRELGLGERKKKEGRMVKWVVVDNGEKSHVCTKYRKHLGHNWGLRQQQQAHREDGG
SAKERPDKCSVCGRCFTQNMALVLHKTLDVGKSHLKGKVSAKCVVKHKKFHTGQEPYRCQ
ECGKCFASSSALLSHKRLHTGEKPYQCQECGKCFADSSALVSHKRLHTGEKPYKCQACGK
CFASSSTLVSHKRLYTGEKPYQCQECGKCFTSSSTLVSHKRLHTGEKPYQCQECGKCFTD
SSALLNQECRKCFADSSTLVKHKRLHTVGKPYQCQECGKCFASISDLVRHKRSHTGEKPY
KCHECGKCFTRTSSLNQHQRTHTG
Download sequence
Identical sequences H9GQC0
ENSACAP00000018099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]