SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9GT12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GT12
Domain Number 1 Region: 11-173
Classification Level Classification E-value
Superfamily RUN domain-like 7.98e-40
Family RUN domain 0.00059
Further Details:      
 
Domain Number 2 Region: 1370-1484
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.54e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1161-1223
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 4 Region: 496-735
Classification Level Classification E-value
Superfamily Tropomyosin 0.000015
Family Tropomyosin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9GT12
Sequence length 1486
Comment (tr|H9GT12|H9GT12_ANOCA) FYVE and coiled-coil domain containing 1 {ECO:0000313|Ensembl:ENSACAP00000019794} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=FYCO1 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MAGSSGESQLQRIIRDLQDAVTELNKEFTEAGEPITDDCVSLHKFSYKLEYLLQFDQKEK
STLLGHRKDYWDYFSDCLAKVKGANDGIRFVKSISELRTSLGKGRAFLRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLNPKMSSDIIGHLYELTEVQFDLASRGYDLDSAWPTFAR
RTLSSLGSSAYLWKPPSRSSSMSSLVSNYLQAQEIPSSPNGNNFLNNEPLEGLDELHTEL
DQAELRQKELQDQIHHLEKENQTLQAAVSFEQQQAQAERENSGRIREENVRLTKMLEELE
KQREISYCTQGTVQDLQKCLQVLELNAAEKQSEYSARLEELEASKRTLTRSELKASLKSA
EQKNEELIAKTLLNEKGQQTKQYESALKFEELQKKVRTVEQEKVDACKLNDKHLSQLKVT
EEELHLKDDARKELEETMATERAVLEKQLAAKGKEAADLQIQLKDSLECVKSLGGKLEEE
REEKVELERSFSLKKTRMEQEVKNTMDQLVLLEIKLSELSQRVNSLEEQKSELVSERDYL
RKILEKMEQQAIEQSSSLRNASERYEKLKSQNAKLQQTNQKLEDKWRALEAYQIDDAVVS
VDEKEKKLREENKLLDENLQNATRQSQVLEERVKTLQKDYQELKQNEDTMKESLSVLEAK
LQSTKEHCLQMENNLSSLRKNEESLKTLLKEKDEALQCLESQCKKFQGEIERCRKKVKIL
EAEKADIENMCLHQTKVIESISSEKTSLEKAQLEHTACQGRKQLHINQAEVGRLQEKMMD
LQAKFQQTVAEKEKLQGKLDIHETVLNEHKSLALQLKEQNEALNRNHVQELLQCQEQEEG
LKKERDQKVHQKAEMEKSVLCLTDELSRVKQCLEMVNMENMEIKDLLHRTNTEMAELGIQ
ICTLTSEKADAEEKLSQLMEELSATKERAAKDQEELHNALSRLSQEKEGLQEKLEDSEIY
AATVPDLRTQLETAERQAQSLQEFSKEELSAVKFQLSTEIINYQTKFKAVNEECEHLQRE
LEKRSQQVSIAEEALKDMQAAKRDLCTKLDLAMDSITECKAALQKKDEELDQLQEDLKRA
QQDVCRANEQIQYSSDNLNKMKSDRDSNEKKLLAELDDLTRTKQFLEERLIELLRFERDK
DALWQKSDALEFQQKLTAEQRWLGDAEVSSCLDCQKEFGWMNRRHHCRLCGRIFCYYCCN
NYAMSKQTGKKERCCQSCFKKDTDPPGSPNEAGSGRGLGQEKPTQFLPPSMPSVLGTVTS
EASKPTDDAVFDIITDEEVGQIQESDNKSQTEDVSLDHSITDLASINPMKGTLSILKAGS
SCINSTLSSLTFDESDDLQMIQDVEICLLKSGELMLKLPLTAEDIFKFGEANRELFIKSN
TYSTIPITVIETGLTISWVFSSEPKSISFSVVYQESEEAPLDQSKVLIPMTRCNSHKETI
HGKVKVRNPGIYILIFDNTFSRFISKKVFFHLAAQRPIIYDGSDFP
Download sequence
Identical sequences H9GT12
ENSACAP00000019794 ENSACAP00000013872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]