SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9GVW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GVW1
Domain Number 1 Region: 79-170
Classification Level Classification E-value
Superfamily Virus ectodomain 6.12e-23
Family Virus ectodomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9GVW1
Sequence length 240
Comment (tr|H9GVW1|H9GVW1_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000021578} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN= OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
LPPGYFWICGKWGGKVLPPLWVGTCTIGTLVPTNIEIHPREQPLQALGATDRWNRPKRSY
DEKRGYNPDNTYLNEGERFGAILFPWVGAALNVKQLRRISAQLEIMANQTVFGIKALQTE
IDSLTGVLMQHKMALDYLLAAEGGLCVWLNITCCHYINESGVIESDVAKINSVVFTIRAK
YTPKGTGWIDWLLNFFSGYLVAEGPHQNIDIMCLCLNIVLSGFTAIMISNLCLETPMTDT
Download sequence
Identical sequences H9GVW1
ENSACAP00000021578 ENSACAP00000021578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]