SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9GW33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GW33
Domain Number 1 Region: 390-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.17e-37
Family Calponin-homology domain, CH-domain 0.000097
Further Details:      
 
Domain Number 2 Region: 87-242,388-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.57e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 972-1005
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000241
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  H9GW33
Domain Number - Region: 1006-1035
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000594
Family LIM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9GW33
Sequence length 1102
Comment (tr|H9GW33|H9GW33_BOVIN) [F-actin]-monooxygenase MICAL2 {ECO:0000313|Ensembl:ENSBTAP00000043575} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MICAL2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
NMGENEDEKQTQAGQLFENFVQASTCKGTLQAFNILTRQLDLDPLDHRNFYSKLKSKVTT
WKAKALWYKLDKRGSHKEYKRGRSCMNTKCLIIGGGPCGLRTAIELAYLGAKVVVVEKRD
TFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALILGVEIHV
NVEFVKVLEPPEDQENQKIGWRAEFLPVDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRG
KLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKKETGIDLENIVYYKDCTHYF
VMTAKRQSLLDKGVIINDYTDTETLLRAENVNQDNLLSYAREAADFATNYQLPSLDFAMN
HYGQPDVAMFDFTSMYASENAALVRERQSHLLLVALVGDSLLEPFWPMGTGCARGFLAAF
DTAWMVKSWDQGTSPLELLAERESLYRLLPQTTPENINKNFEQYTLDPATRYPNLNSNNI
KPNQVKHLYITKELHQYPLERLGSVRRSVGLSRRESDVRPSKLLTWCQQQTEGYQHVNVT
DLTTSWRSGLALCAIIHRFRPDLINFDSLNEDHAVENNQLAFDVAEREFGIAPVITGKEM
ASAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKNYEENADLGLAKSSIPHHYLNLTFP
RKRTPRVDSRTEENDMNKRRRKGFNNLHEPSAFSSQSLGSNQEGIKEGGNQNKVKSMASQ
LLAKFEESSRNPSILRQEHRVSGIGKPILRSSSDPPVNSRCPKPEEPTPSPSPPLKRQFP
SVVVTGHVLRELKQVSAGGECPARPWRARAKSDLQLGGPENLASLPPTCPGALALSGVLR
RLQQVEEKVLQKRAQNLANREFHKKNIKEKAAHLASMFGHGDFPQNKLLSKSLSHTHPPS
SPSCLPSPDSAATSSPSTVDSVSPARKLTVGKVSSGIGAAAEVLVNLYLNDHRPKTQATS
PDLESVRKTFPLNVGGSDTCYFCKKRVYVMERLSAEGRFFHRECFRCSVCATTLHLATYA
FDVDEGKFFCKPHFIHCKTNSQQRKRRAELKQQKEEEGMWKEQEAARRDPPSESSCAAAA
IATPEGSPPVHFSLPVLHPLLG
Download sequence
Identical sequences H9GW33
9913.ENSBTAP00000043575 ENSBTAP00000043575 ENSBTAP00000043575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]