SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9GZX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GZX1
Domain Number 1 Region: 48-324
Classification Level Classification E-value
Superfamily L domain-like 4.28e-57
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 244-482
Classification Level Classification E-value
Superfamily L domain-like 8.5e-42
Family Ngr ectodomain-like 0.038
Further Details:      
 
Domain Number 3 Region: 543-844
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.78e-30
Family Rhodopsin-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9GZX1
Sequence length 907
Comment (tr|H9GZX1|H9GZX1_HORSE) Leucine rich repeat containing G protein-coupled receptor 5 {ECO:0000313|Ensembl:ENSECAP00000009813} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LGR5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MDAPSVGALLALPALLQLAAAGGSPGPGALLRGCPARCRCELDGRTLLRVDCADLGLAAP
PADLSAFTSFLDLSMNNISQLPPHPLRGLRFLEELRLAGNALTSVPKGAFAGLYSLKVLM
LQNNHLRQVPAEALQNLRSLQSLRLDANRIGRVPPGCFGGLRALRHLWLDDNALTEVPVR
AFRSLPALQAVTLALNSIRHVPDGAFAELSSLVVLHLHNNRIHSLGKKCFEGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRLIPEKAFVGNPSLVTLQFYDNPIQLVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTGSLEGLTLTGAQISSLPRTVCAQFPNLRVLDLS
YNLLEDLPSFSGCQKLQKIDLRRNGLCEIRVDTFQQLPALRSLNLAWNKIAIIHPNAFST
LPSLRKLDLSSNRLSSFPVTGLRGLTHLKLTGNHGLQSLISSENFPELKVIEMPYAYQCC
AFGVCESVYKISSQRNEGDNSSTGDLHRKDEGMLQVQDERDLEDFLLDLEEDLQALHSVQ
CSPSPGPFKLCEYLLGNWLIRIGVWTIAVLALTCNALVTSTVFGAPLHLSSVKLLIGLTA
MVNMLTGACSAVLAGVDAVTFGSFARHGAQWEQGVGCQVVGFLSVFASESSVFLLTLAAL
ERGFSVKCSAKFERKAPFSSLKAAILLCAMLALALASAPLLGGREYSTSPLCLPLPFGEP
GTTGYVVALVLLNSFCFLVMTVAYTRLYCGLERGGRGSAWDCCMVRHVALMLFTNCVLHC
PVAFLSFSSLLNLTFVSPEVTRFILLVIVPLPACLNPLLYILFNPHFKEDLGSLGEQTRL
WTRSKHTSLMSVNSDDAEKQSCNSTQALVTFPRARMAYDLPADSTVPPAHPGPESRHLSS
VAFVPCL
Download sequence
Identical sequences H9GZX1
XP_001495480.3.31192 ENSECAP00000009813 ENSECAP00000009813 9796.ENSECAP00000009813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]