SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H091 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H091
Domain Number 1 Region: 21-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-18
Family Ubiquitin-related 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9H091
Sequence length 169
Comment (tr|H9H091|H9H091_MELGA) Transmembrane and ubiquitin like domain containing 1 {ECO:0000313|Ensembl:ENSMGAP00000000920} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=TMUB1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
SLQHQHRAAGLSSAPPGPHSPSSPRAARLXFLNDTERLARVRPGDTVGALKRAYFPGQEQ
QVRLIYQGQLLRDDAQSLAALHLAPNSVLHCHISQHSPAPAPTGPRASADPVHTALNVGS
LMLPLFVLMLAVLWYFQLQYRHVFTATATTFLAGLTLLFSFMAFTMYRR
Download sequence
Identical sequences H9H091
ENSMGAP00000000920 ENSMGAP00000000920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]