SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H108 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H108
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily Sema domain 7.32e-40
Family Sema domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 132-173
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000615
Family Plexin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9H108
Sequence length 178
Comment (tr|H9H108|H9H108_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000006527} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
CITDWHRQNGFPSSLALPDNTLNFAKKHPLMDEPVLPQRGRPLLLKKDSNFTQLVVDRVA
GLDGAVYEVLFVGTGDGWVHKALNLGSHVHLVEELQVFEPAQPVESLVLAGRKKLLFAGS
RLQVAQLPVADCGRYQSCADCVLARDPYCAWSRNGSRCVRSDGLNGSHLVQDVLGSDT
Download sequence
Identical sequences H9H108
ENSMGAP00000006527 ENSMGAP00000006527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]