SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H161 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H161
Domain Number 1 Region: 7-155
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.59e-30
Family Pancreatic carboxypeptidases 0.0000516
Further Details:      
 
Weak hits

Sequence:  H9H161
Domain Number - Region: 156-186
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000112
Family Carboxypeptidase regulatory domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9H161
Sequence length 186
Comment (tr|H9H161|H9H161_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000007246} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
DAVSLQVAPETRAVIDWMQRYPFVLSANLHGGELVVTYPFDMTRTYWKAQELTPTADDGV
FRWLATVYATSNLAMASEERRLCHYDDFMRTGNIINGANWHTVPGSMNDFSYLHTNCFEI
TVELSCDKFPHVSELPTEWENNRESLLLYMEQVHRGIKGVVRDEETGEGIANAIISVDGI
NHDVRT
Download sequence
Identical sequences H9H161
ENSMGAP00000007246 ENSMGAP00000007246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]