SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H1M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H1M8
Domain Number 1 Region: 807-1122
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.06e-75
Family Complement components 0.000000796
Further Details:      
 
Domain Number 2 Region: 1253-1390
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 8.37e-37
Family Alpha-macroglobulin receptor domain 0.00057
Further Details:      
 
Domain Number 3 Region: 1389-1539
Classification Level Classification E-value
Superfamily TIMP-like 7.85e-31
Family Netrin-like domain (NTR/C345C module) 0.0049
Further Details:      
 
Weak hits

Sequence:  H9H1M8
Domain Number - Region: 541-564
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.000484
Family Anaphylotoxins (complement system) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9H1M8
Sequence length 1541
Comment (tr|H9H1M8|H9H1M8_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000010033} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
RGHLIVQTDKPLYAPRQTVRFRVFSMDPDLQPNPEPILVTIMNPMGARVREVQRVPLNTV
LSDQLVLPDIALPGTWHIRAQLAASPNTNGSTAFEVRNMVSEVWGSLLCPMPPYPMCCPQ
CCLALRCGIRPERGFXDPVLPQGDLGSRSGGVRPRRGRGHVNGRGYRGWACVAWRCPAGG
ELVERELLVPLVRSQWVLQLQRSARFFVPGAPYTLLGRVLQAGGGTAPGVPVRVTVGVTG
APAPPLKELRADNSGDITVPINVPKGATRMELSVEAGQPGVPPARAQLLVTPMAAVSGRF
LVLGGPRGSLRPGEELRLQLHHMGPPPAPQRFHLLAMARGRVVVAHTVASQVTLTEVALP
VTADMAPYLHVVAFFLSGGNVVAASWGGCAGGVQVKVPPRGTTLRPQDPLTVTVTTETPV
TVAIGAIDTAVLSLEPRHRLNAAKVEAALGSSDLGCSPGGGPDAVGIFGAAGLVLGLRVA
APQCRQAPHCPPAPTRQRRSLELLKLLEEKGECPMSPCHPIPVSQCLSLSSPSPCHHIPM
SLCRDAFLQCCEVAQNLRRRGQRGGLARVLEAQLAEQLLDDDEDVPTRSFFPESWLWQRV
RVVGTARLSVLLPDSITTWEIQAVAIVPGHGLCVAEPQRVTVTQDVRVALRLPPSIRPRE
QLQLQPLIHSRLPRSINVTVTLSAVEGLCAALDGVPQMLELPPGRAVAAPLTLVALHPGD
IPITVTARGPWGLGDRVTRVLHVEPEGELHLEETTYILDTDDKRSRSLKLPGDVPAEIVP
DGDFSMSVRVGGRVPGWALQGALGVGDSLLRSPRGCGEQSLMSMAPTAAALRFLDESEGW
GQLPPGHRQRGLRTLQQGFERVQSFRKSDGSYGAWLHRDSSTWLTALVLRVLALSRPYLP
VAASGPAESLRWVLEQQRSDGAFLEHRAVVHREMQGGVADPGPEATVLLTAFVVVALHGA
RTLLPPDSPELPLLDKSLSRASTFLRGRVEQLGTYGTAITSYALALVDTTPPGPHPAVER
LRGMARSAHGVSPWGGGTYSGRFVPLRXCAGGRATFWPSGGPAATVEATGYALLALLQSR
DIAGAGRAARWLRQQSNYGGGFHSTQDTVVALEALAQMWLQWGRGSTSGLNLGLSWPGGA
RGRAGGTRMTLKPGLEPLEQELKVPLGSPVTVQVEGHGEGTLTVLRQFRLLSPPNATCQA
LHLEVAITGPILYHDEDYEDYENYEEAEPKEGEEPTEDGPAPLSPMSLWDARKRRRRSTH
SPAHEVAFLVCFRRSPGVALTGMAVVEISLLSGFSPHRTDLDKLRDLVDHWISHYELDGN
QLVLYLDEVPPERQCLSFGATQDVAVGHMQPAMAAIYDYYEPGQRCTIFYNAPQRSSTIA
TLCSPKICECAQGGCPHAQRRTQEVTADDRHDFACYSPRVDYALVVRVLSQSEIGAFVAF
ETEIKEVLLGGQDTTAAPGERRRLLVRKSCPLRLQPHDIYLVMGGSGGHRTPRGGPQFLL
GPHSWVEEVPSPGRCRATRLRSHCAQLQEFRTRLSQLGCQL
Download sequence
Identical sequences H9H1M8
ENSMGAP00000010033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]