SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H6E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H6E8
Domain Number 1 Region: 265-555
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.01e-66
Family Tandem AAA-ATPase domain 0.00033
Further Details:      
 
Domain Number 2 Region: 29-119,209-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.95e-21
Family Tandem AAA-ATPase domain 0.0000947
Further Details:      
 
Domain Number 3 Region: 629-702
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000513
Family GUCT domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9H6E8
Sequence length 717
Comment (tr|H9H6E8|H9H6E8_MONDO) DExD-box helicase 21 {ECO:0000313|Ensembl:ENSMODP00000013441} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=DDX21 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MPGKLLSETEIESEAVMEAAEQTRKHKHKKDKKEKSKNDKLEKEPQEETEELDSPKPKKV
KRGEEVISPKPKKAKKKEQLPEDEEDSSPKPKKAKKKRGGASTDEVSPKAKKTKKKEVPS
ENESPLKPKKTKKKDREVNGDTGEKRPKLEKVKVSNGLSHSKQASDSEESSDEESHSEEE
QELSAEQKEGAFSNFPISEETIQLLKARGVTYLFPIQAKTFHHVSSGKDLIAQARTGTGK
TFSFAIPLVEKLQGDSQPRPRGRAPKILVLAPTRELSIQVSKDFSDITKKLTVACFYGGT
PYNGQIDLIRRGIDILVGTPGRIKDHLQNGRLDLTKVQHVVLDEVDQMLDMGFAEQVEEI
LTVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSTYEQVDLIGKKTQKAAVTVEHLAI
NCHWSQRAAVIGDVIQVYSGSHGRTIIFCETKKEAQELSLNESIKQDAQSLHGDIPQKQR
EITLQGFRNGKFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGI
CICFYQKKEQHQLAQVERQAGITFKRVGVPSASEIIKASSKDAIRFLDSVPPAAINNFRQ
TAQKLIDEKGAVEALAAALAHISGATTVEQRSLINSDVIVGLATEAFCSSLLPRGDPSLS
RDSQPCLGTDGRLGVCFDVPAAEVKSFQDNWQDSRRWQLSVATERPELEQQPDEGRG
Download sequence
Identical sequences H9H6E8
ENSMODP00000013441 ENSMODP00000013441 13616.ENSMODP00000013441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]