SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H7U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H7U9
Domain Number 1 Region: 128-222
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-22
Family I set domains 0.0023
Further Details:      
 
Domain Number 2 Region: 26-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000108
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9H7U9
Sequence length 277
Comment (tr|H9H7U9|H9H7U9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000026423} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC103093817 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVSTLCSLLCFGLYLSQRIQAQEGSLPKPILSAETDLIMTPGSNLSLKCKKPDSDHLMPQ
KWTYLLLKEGNSQPLQNHTATGSWAKFSLLLVTDQDSGNYSCKYLEFQNPQREPEASSAL
EIWVKDILQKLSLSALPQRIITPGENVTLLCHGPAWGMRFALYKEGDEKPMQIHDPIQDE
AEFLLTYVTTNHTGNYSCHHHSDAVNQVMAQPSDPLELIVKGELDIPLRQALGSTTILII
FSCAIILFFLFLLAFCYHRSYIASLADGISLNVCCSH
Download sequence
Identical sequences H9H7U9
ENSMODP00000026423 XP_007506839.1.35504 ENSMODP00000026423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]