SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H871 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H871
Domain Number 1 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-27
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 622-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.95e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 285-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 134-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-21
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 11 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 12 Region: 92-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000216
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9H871
Sequence length 697
Comment (tr|H9H871|H9H871_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000026992} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
VTFQDVAVDFTWEEWRLLSPPQKELYREVMLENARNLLSVGIKNCWGMEIYLVQQGNQEL
EDLSVEEMNLQRFMGDCPDNFAFREFCVAPQNSSDIEHQGIHPGGKSSEDNQCGKTFMQR
AICVGHQRMHSLKKPYECKQCGKTFTCYSDLARHQRIHTGEKPYKCNQCGKSFSQRSSVV
VHQKIHSGEKPYECKQCGKTFRWNSYLAKHQRIHTGEKPYECNQCGKTFHWKSSLVKHQL
IHTGEKPYECKKCGKTFNQSSRLAIHQRIHTGEKPYECNQCGKRFSENSSLGVHQRIHTG
EKPYDCIQCGKRFRLSSHLAVHQRIHSGEKPYECNQCGKTFNRSSSLAVHQKIHSGEKPY
ECNQCGKTFSRSSSLAEHQRIHTGEKPYECNQCGKTFSQSSHLARHQRIHSGEKPYKCNQ
CGKTFSLSSSLAEHQRKHSGEKPYECKLCGKAFTFSWNSSLAVHQRIHTGEKPFECNQCG
KAFSQRTNLAEHQRIHTGEKPYECNQCGKTFSRNSHLAVHQRIHTGEKHYECIQCGKAFS
QRTNLAEHQRIHTWEKPYECNQCGKTFSKSSYLAEHQRIHTGEKPYECNQCGKTFSRNSH
LAVHQRIHTGEKPYNCNQCEKTFSQSTYLAKHQRIHTGEKPYECNQCGKAFSQRTNLAEH
QRIHTGEKPYECNQCGKIFSLSSYLARHQRIHTGEKP
Download sequence
Identical sequences H9H871
ENSMODP00000026992 ENSMODP00000026992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]