SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H8B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H8B7
Domain Number 1 Region: 94-175
Classification Level Classification E-value
Superfamily Immunoglobulin 7.46e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 155-259
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000887
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 11-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000946
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9H8B7
Sequence length 270
Comment (tr|H9H8B7|H9H8B7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000027039} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LCTAPLSKPTILTSNNTAVETKDFSMTCNATGQIHTYLWFLNGLAPGGNRIQLSPDRRTL
TLSSLTRFDNKGPYVCEIENPLFRNRSDPFPLNVTYGPDIATIVHSADEYPPGANITLSC
VADSNPAAQFTWFHNGQPVSNSATFSIIASLSDAGNYTCTAYNSFTGLTRTATKNIIIYA
PLSKPTIVTSNNTAVETKDFSMTCNATGQIHAYQWFINGVAPDGRRIQLSPDRRTLTLSS
LTRFDNKGPYVCEIENPLFRNRSDPFPLNV
Download sequence
Identical sequences H9H8B7
ENSMODP00000027039 ENSMODP00000027039 13616.ENSMODP00000027039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]