SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9H8S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H8S7
Domain Number 1 Region: 48-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000482
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 6-60
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000377
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9H8S7
Sequence length 141
Comment (tr|H9H8S7|H9H8S7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000027207} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC103095944 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNGVAPAGSRIQLSPDKRTLTLSRLTRRDNKGPYECEIRNPIYSNTSDPFTLDVAYGPDI
ATIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCI
ATNSFTGLTRTANKTLMIYGE
Download sequence
Identical sequences H9H8S7
XP_007505637.1.35504 ENSMODP00000027207 ENSMODP00000027207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]