SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9JSK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H9JSK8
Domain Number - Region: 2-84
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0445
Family Spermadhesin, CUB domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9JSK8
Sequence length 238
Comment (tr|H9JSK8|H9JSK8_BOMMO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:BGIBMGA012519-TA} KW=Complete proteome; Reference proteome OX=7091 OS=Bombyx mori (Silk moth). GN= OC=Bombycoidea; Bombycidae; Bombycinae; Bombyx.
Sequence
MIAEPDKKIEVVFNYLDVPCDNGGLVAWIDGWELNGQVWPADSWDDDRLVESCDKRPNRK
LVSRQNAALIQYRVPAQGKGFAVTIRHVRNARPCNVMLFGTEGVFTLRNHGETGNCTLIT
VSPSTVQVLDLNVGQTAKKGRLLELETGTIHHCTKRGLPDHVDIGGASGLDHTKMEVFDS
LCGLDSNEARRASLIACEDTVARLVSSGKYHNSITLAFTPLSLDDIEHADLICGLNDL
Download sequence
Identical sequences H9JSK8
Bmb000323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]