SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9KVV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9KVV4
Domain Number 1 Region: 272-344
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9KVV4
Sequence length 347
Comment (tr|H9KVV4|H9KVV4_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000004919} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
IARLFPDHFLLSLAGCEDFCRSTAPGEGIWKKYELVPSPPTSLPWGLGPGTGHPTPGIGS
PRPDPGCAGDEAESRGHSKASGMNYTCIICHDCMWSGFWAQEQLERAVSDQLTSGTPRGN
LPKASATPYQPRSLQPGAAAPSPLGEPKTQACSGSESPSDLENDVTVEKRQFLGIRKPVT
TVRADPLDPCMKRFHISIHQQQHYTARFPPESCSQEEAPERGPQEEALERDTPGEKEDEE
DEEIVSLPPAESEATPSCHPKPGSSDTEDVTKRKNHNFLERKRQNDLRSRFLALRDQVPT
LASCSTATKVVILSKALGAEKWMATEKRQLRCQQQQLQKRIAYLSGY
Download sequence
Identical sequences H9KVV4
ENSCJAP00000014131 ENSCJAP00000004919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]