SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9KW33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9KW33
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily PH domain-like 2.35e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000657
Further Details:      
 
Weak hits

Sequence:  H9KW33
Domain Number - Region: 178-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0921
Family Spectrin repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9KW33
Sequence length 345
Comment (tr|H9KW33|H9KW33_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000007314} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
AREQPVFSTLAHMFQINPATKQNWIPAGKHALTVSYFYYATRNVYRLISIGGTKAIINST
VTPSMTFTKTSQKFEPWAHANTIYGLGFASEQHLTQFAEKFQEVKEASRLLSREKSQDGR
ELTSPALGLASHQVPPSPLVSANSPEFRVLTPLAPQSMSSSRRCCPRAPWVRYSGRLSPA
LQDSNNKLAGTLREAKAAAAQWRQQLEAQHAEAEQLLQQVAELEAQAGSEVTPASEKEGP
GQDQSLEQLEALVQTKDQEIQTLESQTGGPQEAPEAAKHEETQQKVQDLETHNTELEHQL
WAMEYSLEEAQAEELAQAKVGWVAQLLEVRLFKLSELHEGLARLA
Download sequence
Identical sequences H9KW33
ENSCJAP00000007314 ENSCJAP00000007314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]