SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9KW68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9KW68
Domain Number 1 Region: 405-530
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.22e-27
Family DEP domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 228-339
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-23
Family PDZ domain 0.0000373
Further Details:      
 
Domain Number 3 Region: 2-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.61e-19
Family DIX domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9KW68
Sequence length 684
Comment (tr|H9KW68|H9KW68_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000009837} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
TAETKIIYHMDEEETPYLVKLPVAPERVKLADFKNVLRNRPKFFFKSMDQDFGVVKEEIL
DDNAKLLCFNGRVVSWLVLAEGAHSDASSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNV
ASSRDGMDNETGTESMVSHPGERARRRNREEAARTNGYPRGDRRRDVGLDSASTALSSEL
ESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRMHKLRWRKQRLRQTDRASSSSSITDSTMS
LNIITVTLNMERHHFLGISIVGQSKDHGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVND
VNLENMNNEDAVRVLREIVSQTGPISLTVAKCWDPTPSSYFTVPRADPVRPIDPAAWLSH
AAALTAALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLMVSDMGAVVRVMQLPNS
GLEIRDRMCLKITIHTVIGAHVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKIT
FSEQCFGDLCSNLTALNLNSGSSGASDWDTLALLPHPTTPWPLGQCYRYQYLGPPPCFPP
SYQDPGFSYGSCSTGSQQSEGSKSSGSAQSSRWALGHEKERSVGCHAGGSSTESDHTALS
GVGSSWRECPDGQLSQGRSPRSQASATAPGLPTPHPATKAYTVVGGLPGGPPVRELAAIP
PELTRRQSFQKAMGNPCEFFVDIM
Download sequence
Identical sequences H9KW68
ENSCJAP00000009837 ENSCJAP00000009837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]