SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9UCW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9UCW4
Domain Number 1 Region: 273-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.02e-65
Family Tandem AAA-ATPase domain 0.0000000193
Further Details:      
 
Domain Number 2 Region: 99-269
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-44
Family RecG "wedge" domain 0.00000865
Further Details:      
 
Domain Number 3 Region: 475-686
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.38e-42
Family Tandem AAA-ATPase domain 0.00000152
Further Details:      
 
Domain Number 4 Region: 1-91
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 3.14e-24
Family RecG, N-terminal domain 0.0021
Further Details:      
 
Weak hits

Sequence:  H9UCW4
Domain Number - Region: 706-775
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000515
Family cAMP-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9UCW4
Sequence length 778
Comment (tr|H9UCW4|H9UCW4_FERPD) ATP-dependent DNA helicase RecG {ECO:0000256|RuleBase:RU363016} KW=Complete proteome; Reference proteome OX=771875 OS=Fervidobacterium pennivorans (strain DSM 9078 / Ven5). GN=Ferpe_1277 OC=Fervidobacterium.
Sequence
MLLIEEFLDNCYEISREISEEALNALIEYIEDNYERIDDPLLSDVEIQVKLEEFRNYIIE
AKKLPTHRALKRLSHVRGMVERFKYNFLTYSVTCESSEFAKSLDVPIKYAKGVGPAREKL
LRKLGIQTIGDLISFFPRDYEDRRKVIPLMYVRENEKITTKGILKSVEKTKKGDLIIVSA
LLQDGINQVILKWFNQEFKEMELKQLVGREVYVTGSVKRGFFGAMEIQNPEISLSDSPER
TILPIYPLTENLTQRTIRKIIADNLPSICNLRDLIPKEILEERRLIDVWKAYTGMHFPKS
SFHYKISRKRLAYEELLLFQTALYLSKRNVKQVGGIPKSFSGRLAEEFISKLPFKLTNAQ
KRAHAEIREDMRSPDPMNRLLQGDVGSGKTLVAELAIIDNYEAGYQSAFMVPTSILAIQH
FQKLFNHLTELGIRVALLIGSTSQREKEKIKFALRNGDLDVVVGTHALIQEDVHFANLGL
VIIDEQHRFGVKQREELISKGKVVDTLIMTATPIPRTLSLTLYGDLDVSVIDEMPPGRKE
IKTFTLRHTRAKEVYKFVREQVLENGDQAYIVYPLIEQSEAINAKAAEDMYRTLSKEAFP
DIPMGLLHGRMSDEEKSDVMSKFVRGEIKILVSTSVIEVGVDVPNATIMVIENAERFGLA
QLHQLRGRVGRGEKQSYCFLIVSEAGEEAWDRLQFFASTNDGFKISEYDLRLRGPGEFFG
TRQHGLPEFKVADIISDTELMLIAREDAKRIVENYPDSEIIREVYRIYGERIRFLDVG
Download sequence
Identical sequences H9UCW4
WP_014451796.1.64957 gi|383786907|ref|YP_005471476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]