SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9XVP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9XVP3
Domain Number 1 Region: 71-520
Classification Level Classification E-value
Superfamily Sema domain 1.83e-133
Family Sema domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 1389-1518,1710-1871
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.52e-43
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 882-976
Classification Level Classification E-value
Superfamily E set domains 0.000000000000042
Family Other IPT/TIG domains 0.0076
Further Details:      
 
Domain Number 4 Region: 975-1063
Classification Level Classification E-value
Superfamily E set domains 0.0000000000023
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 5 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000034
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1082-1164
Classification Level Classification E-value
Superfamily E set domains 0.0000000218
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 
Weak hits

Sequence:  H9XVP3
Domain Number - Region: 836-869
Classification Level Classification E-value
Superfamily Plexin repeat 0.000183
Family Plexin repeat 0.0043
Further Details:      
 
Domain Number - Region: 1194-1242
Classification Level Classification E-value
Superfamily E set domains 0.00042
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number - Region: 670-706
Classification Level Classification E-value
Superfamily Plexin repeat 0.00889
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9XVP3
Sequence length 1928
Comment (tr|H9XVP3|H9XVP3_DROME) Plexin A, isoform F {ECO:0000313|EMBL:AFH06788.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG11081 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNFVLSVLLIAILKDKYDYWLPSRTGCQTLAANIWSDKTTAQNEPINLTNANAPIKNAKN
LNSTITNVAAFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS
ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV
ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS
AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE
DSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDVLFAVFSKGE
GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGSGMRGLDFISPSMPCVLTKLQTIGEDFC
GLDVNSPLGGETPITSVPVAMFNTKLTSVAATSTSGYTVVFVGTSDGFLKKVVIESSSIA
NEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYC
GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP
QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
CLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFQPKTGPWEGG
TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK
ILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIK
VPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYASPCRVQSDTEMECASPVVDVDSH
VIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERVKYFKSEYLTING
RNLDRACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEY
RIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQM
DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE
RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS
HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV
TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHNRAGSPLNNDMH
ENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHR
GSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSN
IVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYRDIRDMSPIS
DQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTLEEDEFSQKQRLAFKLEQ
VHNIMSSE
Download sequence
Identical sequences H9XVP3
NP_001245428.1.81976 FBpp0301599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]