SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9YVZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9YVZ4
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily NTF2-like 4.48e-36
Family NTF2-like 0.003
Further Details:      
 
Domain Number 2 Region: 336-443
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.04e-19
Family Canonical RBD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9YVZ4
Sequence length 466
Comment (tr|H9YVZ4|H9YVZ4_MACMU) Ras GTPase-activating protein-binding protein 1 {ECO:0000313|EMBL:AFH27860.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=G3BP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKE
IHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSV
ANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVS
NDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDTQKSSSPAPADIAQ
TVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRD
QRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFF
QNYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE
GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ
Download sequence
Identical sequences A0A0D9REQ6 A0A2K5W452 A0A2K6AZR6 A0A2K6MNK6 A0A2K6P4V0 H9YVZ4
9544.ENSMMUP00000019286 NP_001248671.1.72884 XP_005558381.2.63531 XP_005558382.1.63531 XP_008013254.1.81039 XP_010356954.1.97406 XP_010356955.1.97406 XP_010356956.1.97406 XP_010356957.1.97406 XP_011714220.1.29376 XP_011714221.1.29376 XP_011714222.1.29376 XP_014996748.1.72884 XP_014996750.1.72884 XP_015307646.1.63531 XP_017731217.1.44346 ENSPANP00000002460 ENSMMUP00000019286 ENSMMUP00000019286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]